The short version of reverse-phase HPLC fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-12-28 and is reviewed periodically as new material appears.
The designation TB-500 circulates in laboratory and catalog contexts without a single agreed definition. Most product listings apply it to an N-terminally acetylated seven-residue fragment of thymosin beta-4, while other listings attach the same label to the full 43-residue protein. Because the term is commercial rather than systematic, two entries bearing identical names may describe different molecules. Any documentation should therefore state which sequence a given sample is claimed to contain.
The fragment most often associated with the name carries the sequence Ac-LKKTETQ, matching residues 17 through 23 of thymosin beta-4. That region holds the actin-binding motif responsible for much of the parent protein's biochemical activity. Apart from N-terminal acetylation the peptide is unmodified and contains no disulfide bonds, so it shows little ordered secondary structure in solution. Full-length thymosin beta-4 is instead a 43-residue polypeptide of roughly 4.9 kDa found widely across mammalian cell types.
Material sold under this label typically arrives as a freeze-dried powder in a sealed vial with a certificate of analysis. Such certificates usually report reversed-phase chromatography purity plus a mass confirmation, and stated purities commonly sit between 95 and 99 percent. Counter-ion identity, residual trifluoroacetate, water content, and peptide net weight are separate specifications that a certificate may or may not include. A purity figure alone does not establish sequence identity, so independent mass verification remains the practical check.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | ≈889 Da for the 7-residue fragment | Full-length thymosin beta-4 is ≈4.9 kDa; catalogs differ |
| Appearance | White to off-white powder | Hygroscopic; weight shifts with residual moisture |
| Solubility class | Freely soluble in water | Also dissolves in aqueous buffers; poorly soluble in nonpolar solvents |
| Typical storage temperature | −20 °C, desiccated, protected from light | Once rehydrated, short-term holding at 2-8 °C |
| Typical analytical method | Reversed-phase HPLC with mass spectrometry | Purity by UV absorbance; identity by ESI-MS or MALDI-TOF |
Thymosin beta-4 itself is a small, widely expressed protein that sequesters monomeric actin and participates in cell migration, angiogenesis, and tissue repair. Researchers have examined the shortened fragment as a possible mimic of some of these activities, reasoning that the actin-binding motif lies within the first few residues. Binding to monomeric actin has been observed in cell-free systems. Whether the fragment reproduces the broader effects of the full protein in living tissue remains an open question, and findings from animal models are frequently cited without a clear bridge to human physiology.
Discussion of TB-500 appears in several distinct literatures that rarely cite one another. Peer-reviewed studies usually describe in vitro assays or small animal experiments and are cautious about extrapolation. Veterinary and sports communities circulate anecdotal reports with limited methodological detail. Commercial listings add a third layer, often using the name interchangeably with thymosin beta-4 even though the two molecules differ in size and sequence. Regulatory status varies by country, and the compound is not a licensed medicine in most jurisdictions, so readers comparing sources should check which molecule and which purity each source actually describes.
Identity and purity are assessed with a small set of standard techniques. Reverse-phase high-performance liquid chromatography gives a purity estimate from peak area, usually recorded at 214 or 220 nanometers, where the peptide bond absorbs. Mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidized species. Amino acid analysis or tandem mass spectrometry sequencing can verify the sequence itself. Additional quality attributes include water content, residual trifluoroacetic acid carried over from purification, and endotoxin where the material is intended for biological work.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
Storage recommendations center on keeping the dry powder cold, dry, and dark. A freezer at -20 degrees Celsius or below is conventional, and desiccant is often included to limit moisture uptake. Once dissolved, the peptide is less stable, and solutions are typically kept frozen and thawed only once. Repeated freeze-thaw cycles are a common source of losses because they promote aggregation and adsorption to container surfaces. Working aliquots are therefore prepared in advance, and glass or low-binding plastic is usually preferred over ordinary laboratory plastic.
=== Mesosoma === Both the wings and the 6 legs of the ant are attached to the mesosoma ("thorax"). The legs terminate in a hooked claw which allows them to hook on and climb surfaces. Only reproductive ants (queens and males) have wings. Queens shed their wings after the nuptial flight, leaving visible stubs, a distinguishing feature of queens. In a few species, wingless queens (ergatoids) and males occur.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
IDF soldiers have three types of insignia, other than rank insignia, which identify their corps, specific unit, and position. A pin attached to the beret identifies a soldier's corps. Soldiers serving in staffs above corps level are often identified by the General Corps pin, despite not officially belonging to it, or the pin of a related corps. New recruits undergoing tironut (basic training) do not have a pin. Beret colors are also often indicative of the soldier's corps. Most non-combat corps do not have their own beret, and sometimes wear the color of the corps to which the post they're stationed in belongs. Individual units are identified by a shoulder tag attached to the left shoulder strap. Most units in the IDF have their own tags, although those that do not, generally use tags identical to their command's tag (corps, directorate, or regional command). While one cannot always identify the position/job of a soldier, two optional factors help make this identification: an aiguillette attached to the left shoulder strap and shirt pocket, and a pin indicating the soldier's work type, usually given by a professional course. Other pins may indicate the corps or additional courses taken. An optional battle pin indicates a war that a soldier has fought in.
Sources: en.wikipedia.org
Morphine, formerly known as morphium, is an opiate found naturally in opium, a dark brown resin produced by drying the latex of opium poppies (Papaver somniferum). It is mainly used as an analgesic (pain medication). There are multiple methods used to administer morphine: oral; sublingual; via inhalation; injection into a muscle, injection under the skin, or injection into the spinal cord area; transdermal; intravenously; or via rectal suppository. It acts directly on the central nervous system (CNS) to induce analgesia and alter perception and emotional response to pain. Physical and psychological dependence and tolerance may develop with repeated administration. It can be taken for both acute pain and chronic pain and is frequently used for pain from myocardial infarction, kidney stones, and during labor. Its maximum effect is reached after about 20 minutes when administered intravenously and 60 minutes when administered by mouth, while the duration of its effect is 3–7 hours. Long-acting formulations of morphine are sold under the brand names MS Contin and Kadian, among others. Generic long-acting formulations are also available. Common side effects of morphine include drowsiness, euphoria, nausea, dizziness, sweating, and constipation. Potentially serious side effects of morphine include decreased respiratory effort, vomiting, and low blood pressure. Morphine is highly addictive and prone to abuse. If one's dose is reduced after long-term use, opioid withdrawal symptoms may occur.
The concept of hospital as institution to offer medical care and possibility of a cure for the patients due to the ideals of Christian charity, rather than just merely a place to die, appeared in the Byzantine Empire. Although the concept of uroscopy was known to Galen, he did not see the importance of using it to localize the disease. It was under the Byzantines with physicians such of Theophilus Protospatharius that they realized the potential in uroscopy to determine disease in a time when no microscope or stethoscope existed. That practice eventually spread to the rest of Europe. After 750 CE, the Muslim world had the works of Hippocrates, Galen and Sushruta translated into Arabic, and Islamic physicians engaged in some significant medical research. Notable Islamic medical pioneers include the Persian polymath, Avicenna, who, along with Imhotep and Hippocrates, has also been called the "father of medicine". He wrote The Canon of Medicine which became a standard medical text at many medieval European universities, considered one of the most famous books in the history of medicine. Others include Abulcasis, Avenzoar, Ibn al-Nafis, and Averroes. Persian physician Rhazes was one of the first to question the Greek theory of humorism, which nevertheless remained influential in both medieval Western and medieval Islamic medicine. Some volumes of Rhazes's work Al-Mansuri, namely "On Surgery" and "A General Book on Therapy", became part of the medical curriculum in European universities.
=== Reactivity control === Chemoselectivity ensures that a specific functional group in a molecule reacts while others remain unaffected. Protecting groups temporarily mask reactive sites to enable selective reactions. Kinetic control prioritizes reaction pathways that form products quickly, often yielding less stable compounds. In contrast, thermodynamic control favors the formation of the most stable products.
Grade I: Mild ptosis—The nipple is at the level of the infra-mammary fold and above most of the lower breast tissue. Grade II: Moderate ptosis—The nipple is located below the infra-mammary fold but higher than most of the breast tissue hangs. Grade III: Advanced ptosis—The nipple is below the inframammary fold and at the level of maximum breast projection. Pseudoptosis—The nipple is located either at or above the infra-mammary fold, while the lower half of the breast sags below the fold. This is most often seen when a woman stops nursing, as her milk glands atrophy, causing her breast tissue to sag. Parenchymal Maldistribution—The lower breast tissue is lacking fullness, the inframammary fold is very high, and the nipple and areola are relatively close to the fold. This is usually a developmental deformity.
Sources: en.wikipedia.org
Usually not, though usage overlaps. The label most often refers to a short acetylated fragment of the parent protein, while thymosin beta-4 itself is the full 43-residue molecule. Because suppliers vary, a sequence statement is needed to settle the question for any particular lot.
The name is a commercial label rather than a systematic chemical designation, so different vendors and papers attach it to different sequences. Some treat it as a fragment and others as the whole protein. Comparing two reports therefore requires checking what each one actually analyzed.
Typically it reflects the relative area of the main peak in a reversed-phase chromatogram at a given wavelength. It does not confirm the amino acid sequence, the counter-ion, or the amount of peptide by mass. Identity is normally established by a separate mass measurement.
The leading proposal involves sequestration of monomeric actin, which would alter cytoskeletal turnover and cell movement. The actin-binding motif shared with the parent protein is central to that idea. Direct confirmation in whole organisms remains limited.